Coverage for local/lib/python2.7/site-packages/sage/crypto/classical.py : 89%

Hot-keys on this page
r m x p toggle line displays
j k next/prev highlighted chunk
0 (zero) top of page
1 (one) first highlighted chunk
r""" Classical Cryptosystems
A convenient user interface to various classical ciphers. These include:
- affine cipher; see :class:`AffineCryptosystem` - Hill or matrix cipher; see :class:`HillCryptosystem` - shift cipher; see :class:`ShiftCryptosystem` - substitution cipher; see :class:`SubstitutionCryptosystem` - transposition cipher; see :class:`TranspositionCryptosystem` - Vigenere cipher; see :class:`VigenereCryptosystem`
These classical cryptosystems support alphabets such as:
- the capital letters of the English alphabet; see :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>` - the hexadecimal number system; see :func:`HexadecimalStrings() <sage.monoids.string_monoid.HexadecimalStrings>` - the binary number system; see :func:`BinaryStrings() <sage.monoids.string_monoid.BinaryStrings>` - the octal number system; see :func:`OctalStrings() <sage.monoids.string_monoid.OctalStrings>` - the radix-64 number system; see :func:`Radix64Strings() <sage.monoids.string_monoid.Radix64Strings>`
AUTHORS:
- David Kohel (2007): initial version with the Hill, substitution, transposition, and Vigenere cryptosystems.
- Minh Van Nguyen (2009-08): shift cipher, affine cipher """
#***************************************************************************** # Copyright (C) 2007 David Kohel <kohel@maths.usyd.edu.au> # # This program is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 2 of the License, or # (at your option) any later version. # http://www.gnu.org/licenses/ #*****************************************************************************
# TODO: check off this todo list: # - methods to cryptanalyze the Hill, substitution, transposition, and # Vigenere ciphers
StringMonoid_class, AlphabeticStringMonoid)
AffineCipher, HillCipher, ShiftCipher, SubstitutionCipher, TranspositionCipher, VigenereCipher)
r""" Create an affine cryptosystem.
Let `A = \{ a_0, a_1, a_2, \dots, a_{n-1} \}` be a non-empty alphabet consisting of `n` unique elements. Define a mapping `f : A \longrightarrow \ZZ / n\ZZ` from the alphabet `A` to the set `\ZZ / n\ZZ` of integers modulo `n`, given by `f(a_i) = i`. Thus we can identify each element of the alphabet `A` with a unique integer `0 \leq i < n`. A key of the affine cipher is an ordered pair of integers `(a, b) \in \ZZ / n\ZZ \times \ZZ / n\ZZ` such that `\gcd(a, n) = 1`. Therefore the key space is `\ZZ / n\ZZ \times \ZZ / n\ZZ`. Since we assume that `A` does not have repeated elements, the mapping `f : A \longrightarrow \ZZ/ n\ZZ` is bijective. Encryption and decryption functions are both affine functions. Let `(a,b)` be a secret key, i.e. an element of the key space, and let `p` be a plaintext character and consequently `p \in \ZZ / n\ZZ`. Then the ciphertext character `c` corresponding to `p` is given by
.. MATH::
c \equiv ap + b \pmod{n}
Similarly, given a ciphertext character `c \in \ZZ / n\ZZ` and a secret key `(a,b)`, we can recover the corresponding plaintext character as follows:
.. MATH::
p \equiv a^{-1} (c - b) \pmod{n}
where `a^{-1}` is the inverse of `a` modulo `n`. Use the bijection `f : A \longrightarrow \ZZ / n\ZZ` to convert `c` and `p` back to elements of the alphabet `A`. Currently, only the following alphabet is supported for the affine cipher:
- capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`
EXAMPLES:
Encryption and decryption over the capital letters of the English alphabet::
sage: A = AffineCryptosystem(AlphabeticStrings()); A Affine cryptosystem on Free alphabetic string monoid on A-Z sage: P = A.encoding("The affine cryptosystem generalizes the shift cipher.") sage: P THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER sage: a, b = (9, 13) sage: C = A.enciphering(a, b, P); C CYXNGGHAXFKVSCJTVTCXRPXAXKNIHEXTCYXTYHGCFHSYXK sage: A.deciphering(a, b, C) THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER sage: A.deciphering(a, b, C) == P True
We can also use functional notation to work through the previous example::
sage: A = AffineCryptosystem(AlphabeticStrings()); A Affine cryptosystem on Free alphabetic string monoid on A-Z sage: P = A.encoding("The affine cryptosystem generalizes the shift cipher.") sage: P THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER sage: a, b = (9, 13) sage: E = A(a, b); E Affine cipher on Free alphabetic string monoid on A-Z sage: C = E(P); C CYXNGGHAXFKVSCJTVTCXRPXAXKNIHEXTCYXTYHGCFHSYXK sage: aInv, bInv = A.inverse_key(a, b) sage: D = A(aInv, bInv); D Affine cipher on Free alphabetic string monoid on A-Z sage: D(C) THEAFFINECRYPTOSYSTEMGENERALIZESTHESHIFTCIPHER sage: D(C) == P True sage: D(C) == P == D(E(P)) True
Encrypting the ciphertext with the inverse key also produces the plaintext::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: P = A.encoding("Encrypt with inverse key.") sage: a, b = (11, 8) sage: C = A.enciphering(a, b, P) sage: P; C ENCRYPTWITHINVERSEKEY AVENMRJQSJHSVFANYAOAM sage: aInv, bInv = A.inverse_key(a, b) sage: A.enciphering(aInv, bInv, C) ENCRYPTWITHINVERSEKEY sage: A.enciphering(aInv, bInv, C) == P True
For a secret key `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ`, if `a = 1` then any affine cryptosystem with key `(1, b)` for any `b \in \ZZ/n\ZZ` is a shift cryptosystem. Here is how we can create a Caesar cipher using an affine cipher::
sage: caesar = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (1, 3) sage: P = caesar.encoding("abcdef"); P ABCDEF sage: C = caesar.enciphering(a, b, P); C DEFGHI sage: caesar.deciphering(a, b, C) == P True
Any affine cipher with keys of the form `(a,0) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` is called a decimation cipher on the Roman alphabet, or decimation cipher for short::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: P = A.encoding("A decimation cipher is a specialized affine cipher.") sage: a, b = (17, 0) sage: C = A.enciphering(a, b, P) sage: P; C ADECIMATIONCIPHERISASPECIALIZEDAFFINECIPHER AZQIGWALGENIGVPQDGUAUVQIGAFGJQZAHHGNQIGVPQD sage: A.deciphering(a, b, C) == P True
Generate a random key for encryption and decryption::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: P = A.encoding("An affine cipher with a random key.") sage: a, b = A.random_key() sage: C = A.enciphering(a, b, P) sage: A.deciphering(a, b, C) == P True
TESTS:
The binary number system is currently not a supported alphabet of this affine cryptosystem::
sage: AffineCryptosystem(BinaryStrings()) Traceback (most recent call last): ... TypeError: A (= Free binary string monoid) is not supported as a cipher domain of this affine cryptosystem.
Nor are the octal, hexadecimal, and radix-64 number systems supported::
sage: AffineCryptosystem(OctalStrings()) Traceback (most recent call last): ... TypeError: A (= Free octal string monoid) is not supported as a cipher domain of this affine cryptosystem. sage: AffineCryptosystem(HexadecimalStrings()) Traceback (most recent call last): ... TypeError: A (= Free hexadecimal string monoid) is not supported as a cipher domain of this affine cryptosystem. sage: AffineCryptosystem(Radix64Strings()) Traceback (most recent call last): ... TypeError: A (= Free radix 64 string monoid) is not supported as a cipher domain of this affine cryptosystem.
A secret key `(a,b)` must be an element of `\ZZ/n\ZZ \times \ZZ/n\ZZ` with `\gcd(a,n) = 1`. This rules out the case `a = 0` irrespective of the value of `b`. For the upper-case letters of the English alphabet, where the alphabet size is `n = 26`, `a` cannot take on any even value::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A(0, 1) Traceback (most recent call last): ... ValueError: (a, b) = (0, 1) is outside the range of acceptable values for a key of this affine cryptosystem. sage: A(2, 1) Traceback (most recent call last): ... ValueError: (a, b) = (2, 1) is outside the range of acceptable values for a key of this affine cryptosystem.
REFERENCES:
- [Sti2006]_ """
r""" See ``AffineCryptosystem`` for full documentation.
INPUT:
- ``A`` -- a string monoid over some alphabet; this is the non-empty alphabet over which the plaintext and ciphertext spaces are defined.
OUTPUT:
- An affine cryptosystem over the alphabet ``A``.
EXAMPLES:
Testing of dumping and loading objects::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A == loads(dumps(A)) True """ # sanity check # List L of invertible linear coefficients modulo n, where n is the # alphabet size. Each e in L satisfies gcd(e, n) = 1. # Initialize the affine cryptosystem with the plaintext, ciphertext, # and key spaces. self, A, A, key_space=(IntegerModRing(A.ngens()), IntegerModRing(A.ngens())))
r""" Create an affine cipher with secret key ``(a,b)``.
INPUT:
- ``(a,b)`` -- a secret key; this key is used for both encryption and decryption. For the affine cryptosystem whose plaintext and ciphertext spaces are `A`, a key is an ordered pair `(a,b) \in \ZZ / n\ZZ \times \ZZ / n\ZZ` where `n` is the size or cardinality of the set `A` and `\gcd(a,n) = 1`.
OUTPUT:
- An affine cipher with secret key ``(a,b)``.
EXAMPLES::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: P = A.encoding("Fine here, fine there."); P FINEHEREFINETHERE sage: a, b = (17, 3) sage: E = A(a, b); E Affine cipher on Free alphabetic string monoid on A-Z sage: E(P) KJQTSTGTKJQTOSTGT sage: C = E(P) sage: C KJQTSTGTKJQTOSTGT sage: aInv, bInv = A.inverse_key(a, b) sage: D = A(aInv, bInv); D Affine cipher on Free alphabetic string monoid on A-Z sage: P == D(C) True sage: D(E(P)) FINEHEREFINETHERE
TESTS:
The key must be an ordered pair `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` with `n` being the size of the plaintext and ciphertext spaces. Furthermore, `a` must be relatively prime to `n`, i.e. `\gcd(a,n) = 1`::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A(2, 3) Traceback (most recent call last): ... ValueError: (a, b) = (2, 3) is outside the range of acceptable values for a key of this affine cryptosystem. """ # Sanity check: the key K = (a,b) must be an element of # ZZ/nZZ x ZZ/nZZ where n is the size of the plaintext and ciphertext # spaces. For the affine cryptosystem, these two spaces are the # same alphabet. # If a is an element of the multiplicative group G of ZZ/nZZ, then # gcd(a,n) = 1. So here we don't need to explicitly test that # a is coprime to n since we assume that the list # self._invertible_A contains all the elements of G. else:
r""" Return the string representation of ``self``.
EXAMPLES::
sage: A = AffineCryptosystem(AlphabeticStrings()); A Affine cryptosystem on Free alphabetic string monoid on A-Z """ # The affine cipher has the plaintext and ciphertext spaces defined # over the same non-empty alphabet. The cipher domain is the same # as the alphabet used for the plaintext and ciphertext spaces.
r""" Use the chi-square statistic to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet `A` consisting of `n` elements, and let `C` be a ciphertext encoded using elements of `A`. The plaintext `P` corresponding to `C` is also encoded using elements of `A`. Let `M` be a candidate decipherment of `C`, i.e. `M` is the result of attempting to decrypt `C` using a key `(a,b)` which is not necessarily the same key used to encrypt `P`. Suppose `F_A(e)` is the characteristic frequency probability of `e \in A` and let `F_M(e)` be the message frequency probability with respect to `M`. The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of `M` provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability `F_A(e)` as the expected probability, while the message frequency probability `F_M(e)` is the observed probability. If `M` is of length `L`, then the observed frequency of `e \in A` is
.. MATH::
O_M(e) = F_M(e) \cdot L
and the expected frequency of `e \in A` is
.. MATH::
E_A(e) = F_A(e) \cdot L
The chi-square rank `R_{\chi^2}(M)` of `M` corresponding to a key `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` is given by
.. MATH::
R_{\chi^2}(M) = \sum_{e \in A} \frac {\big( O_M(e) - E_A(e) \big)^2} {E_A(e)}
Cryptanalysis by exhaustive key search produces a candidate decipherment `M_{a,b}` for each possible key `(a,b)`. For a set `D = \big\{M_{a_1,b_1}, M_{a_2,b_2}, \dots, M_{a_k,b_k} \big\}` of all candidate decipherments corresponding to a ciphertext `C`, the smaller is the rank `R_{\chi^2}(M_{a_i,b_i})` the more likely that `(a_i,b_i)` is the secret key. This key ranking method is based on the Pearson chi-square test [PearsonTest]_.
INPUT:
- ``C`` -- The ciphertext, a non-empty string. The ciphertext must be encoded using the upper-case letters of the English alphabet.
- ``pdict`` -- A dictionary of key, possible plaintext pairs. This should be the output of :func:`brute_force` with ``ranking="none"``.
OUTPUT:
- A list ranking the most likely keys first. Each element of the list is a tuple of key, possible plaintext pairs.
EXAMPLES:
Use the chi-square statistic to rank all possible keys and their corresponding decipherment::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 7) sage: P = A.encoding("Line.") sage: C = A.enciphering(a, b, P) sage: Plist = A.brute_force(C) sage: Rank = A.rank_by_chi_square(C, Plist) sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((1, 1), NETS), ((3, 7), LINE), ((17, 20), STAD), ((5, 2), SLOT), ((5, 5), HADI), ((9, 25), TSLI), ((17, 15), DELO), ((15, 6), ETUN), ((21, 8), ELID), ((7, 17), HCTE)]
As more ciphertext is available, the reliability of the chi-square ranking function increases::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (11, 24) sage: P = A.encoding("Longer message is more information for cryptanalysis.") sage: C = A.enciphering(a, b, P) sage: Plist = A.brute_force(C) sage: Rank = A.rank_by_chi_square(C, Plist) sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((11, 24), LONGERMESSAGEISMOREINFORMATIONFORCRYPTANALYSIS), ((17, 9), INURFSBFLLHRFDLBNSFDUYNSBHEDNUYNSTSVGEHUHIVLDL), ((9, 18), RMFIUHYUOOSIUWOYMHUWFBMHYSVWMFBMHGHETVSFSREOWO), ((15, 12), VSTACPUCOOGACYOUSPCYTBSPUGNYSTBSPEPIRNGTGVIOYO), ((3, 22), PAFOYLKYGGSOYEGKALYEFTALKSBEAFTALILCVBSFSPCGEG), ((25, 3), OHSRNADNPPFRNVPDHANVSCHADFEVHSCHAJABWEFSFOBPVP), ((7, 25), GHYNVIPVRRLNVFRPHIVFYEHIPLAFHYEHIDITQALYLGTRFR), ((5, 2), NEHCIVKISSUCIWSKEVIWHFEVKUPWEHFEVOVABPUHUNASWS), ((15, 25), IFGNPCHPBBTNPLBHFCPLGOFCHTALFGOFCRCVEATGTIVBLB), ((9, 6), BWPSERIEYYCSEGYIWREGPLWRICFGWPLWRQRODFCPCBOYGY)]
TESTS:
The ciphertext cannot be an empty string::
sage: A.rank_by_chi_square("", Plist) Traceback (most recent call last): ... AttributeError: 'str' object has no attribute 'parent' sage: A.rank_by_chi_square(A.encoding(""), Plist) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string. sage: A.rank_by_chi_square(A.encoding(" "), Plist) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`::
sage: H = HexadecimalStrings() sage: A.rank_by_chi_square(H.encoding("shift"), Plist) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet. sage: B = BinaryStrings() sage: A.rank_by_chi_square(B.encoding("shift"), Plist) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary ``pdict`` cannot be empty::
sage: A.rank_by_chi_square(C, {}) Traceback (most recent call last): ... KeyError: (1, 0) """ # NOTE: the code here is very similar to that in the method # rank_by_chi_square() of the class ShiftCryptosystem. The most # significant change in the code below is in how the secret key (a,b) # is processed.
# sanity check
# compute the rank of each key # the alphabet in question # message length # expected frequency tally # Compute the rank R_{chi^2}(M) of M with secret key (a,b). # observed frequency tally else: # the rank R_{chi^2}(M) of M with secret key (a,b) # Sort in non-decreasing order of chi-square statistic. It's # possible that two different keys share the same chi-square # statistic. # NOTE: each secret key is a tuple (a,b). So key[0] indexes a, # and key[1] indexes b. The value of val is not used at all, making # it redundant to access val in the first place. The following line # of code is written with readability in mind. for val, key in Rank]
r""" Use the squared-differences measure to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet `A` consisting of `n` elements, and let `C` be a ciphertext encoded using elements of `A`. The plaintext `P` corresponding to `C` is also encoded using elements of `A`. Let `M` be a candidate decipherment of `C`, i.e. `M` is the result of attempting to decrypt `C` using a key `(a,b)` which is not necessarily the same key used to encrypt `P`. Suppose `F_A(e)` is the characteristic frequency probability of `e \in A` and let `F_M(e)` be the message frequency probability with respect to `M`. The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of `M` provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability `F_A(e)` as the expected probability, while the message frequency probability `F_M(e)` is the observed probability. If `M` is of length `L`, then the observed frequency of `e \in A` is
.. MATH::
O_M(e) = F_M(e) \cdot L
and the expected frequency of `e \in A` is
.. MATH::
E_A(e) = F_A(e) \cdot L
The squared-differences, or residual sum of squares, rank `R_{RSS}(M)` of `M` corresponding to a key `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` is given by
.. MATH::
R_{RSS}(M) = \sum_{e \in A} \big( O_M(e) - E_A(e) \big)^2
Cryptanalysis by exhaustive key search produces a candidate decipherment `M_{a,b}` for each possible key `(a,b)`. For a set `D = \big\{M_{a_1,b_1}, M_{a_2,b_2}, \dots, M_{a_k,b_k} \big\}` of all candidate decipherments corresponding to a ciphertext `C`, the smaller is the rank `R_{RSS}(M_{a_i,b_i})` the more likely that `(a_i,b_i)` is the secret key. This key ranking method is based on the residual sum of squares measure [RSS]_.
INPUT:
- ``C`` -- The ciphertext, a non-empty string. The ciphertext must be encoded using the upper-case letters of the English alphabet.
- ``pdict`` -- A dictionary of key, possible plaintext pairs. This should be the output of :func:`brute_force` with ``ranking="none"``.
OUTPUT:
- A list ranking the most likely keys first. Each element of the list is a tuple of key, possible plaintext pairs.
EXAMPLES:
Use the method of squared differences to rank all possible keys and their corresponding decipherment::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 7) sage: P = A.encoding("Line.") sage: C = A.enciphering(a, b, P) sage: Plist = A.brute_force(C) sage: Rank = A.rank_by_squared_differences(C, Plist) sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((1, 1), NETS), ((15, 6), ETUN), ((7, 17), HCTE), ((3, 7), LINE), ((17, 15), DELO), ((9, 4), EDWT), ((9, 9), POHE), ((21, 8), ELID), ((17, 20), STAD), ((7, 18), SNEP)]
As more ciphertext is available, the reliability of the squared-differences ranking function increases::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (11, 24) sage: P = A.encoding("Longer message is more information for cryptanalysis.") sage: C = A.enciphering(a, b, P) sage: Plist = A.brute_force(C) sage: Rank = A.rank_by_squared_differences(C, Plist) sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((11, 24), LONGERMESSAGEISMOREINFORMATIONFORCRYPTANALYSIS), ((9, 14), DYRUGTKGAAEUGIAKYTGIRNYTKEHIYRNYTSTQFHEREDQAIA), ((23, 24), DSNEUHIUMMAEUOMISHUONZSHIAROSNZSHKHQXRANADQMOM), ((23, 1), ETOFVIJVNNBFVPNJTIVPOATIJBSPTOATILIRYSBOBERNPN), ((21, 16), VEBGANYAQQOGAMQYENAMBDENYOTMEBDENUNIHTOBOVIQMQ), ((7, 12), TULAIVCIEEYAISECUVISLRUVCYNSULRUVQVGDNYLYTGESE), ((5, 20), ZQTOUHWUEEGOUIEWQHUITRQHWGBIQTRQHAHMNBGTGZMEIE), ((21, 8), JSPUOBMOEECUOAEMSBOAPRSBMCHASPRSBIBWVHCPCJWEAE), ((25, 7), SLWVREHRTTJVRZTHLERZWGLEHJIZLWGLENEFAIJWJSFTZT), ((25, 15), ATEDZMPZBBRDZHBPTMZHEOTMPRQHTEOTMVMNIQRERANBHB)]
TESTS:
The ciphertext cannot be an empty string::
sage: A.rank_by_squared_differences("", Plist) Traceback (most recent call last): ... AttributeError: 'str' object has no attribute 'parent' sage: A.rank_by_squared_differences(A.encoding(""), Plist) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string. sage: A.rank_by_squared_differences(A.encoding(" "), Plist) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`::
sage: H = HexadecimalStrings() sage: A.rank_by_squared_differences(H.encoding("line"), Plist) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet. sage: B = BinaryStrings() sage: A.rank_by_squared_differences(B.encoding("line"), Plist) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary ``pdict`` cannot be empty::
sage: A.rank_by_squared_differences(C, {}) Traceback (most recent call last): ... KeyError: (1, 0) """ # NOTE: the code here is very similar to that in the method # rank_by_squared_differences() of the class ShiftCryptosystem. # The most significant change in the code below is in how the # secret key (a,b) is processed.
# sanity check
# compute the rank of each key # the alphabet in question # message length # expected frequency tally # Compute the rank R_{RSS}(M) of M with secret key (a,b). # observed frequency tally else: # the rank R_{RSS}(M) of M with secret key (a,b) # Sort in non-decreasing order of squared-differences statistic. It's # possible that two different keys share the same squared-differences # statistic. # NOTE: each secret key is a tuple (a,b). So key[0] indexes a, # and key[1] indexes b. The value of val is not used at all, making # it redundant to access val in the first place. The following line # of code is written with readability in mind. for val, key in Rank]
r""" Attempt a brute force cryptanalysis of the ciphertext ``C``.
INPUT:
- ``C`` -- A ciphertext over one of the supported alphabets of this affine cryptosystem. See the class :class:`AffineCryptosystem` for documentation on the supported alphabets.
- ``ranking`` -- (default ``"none"``) the method to use for ranking all possible keys. If ``ranking="none"``, then do not use any ranking function. The following ranking functions are supported:
- ``"chi_square"`` -- the chi-square ranking function as implemented in the method :func:`rank_by_chi_square`.
- ``"squared_differences"`` -- the squared differences ranking function as implemented in the method :func:`rank_by_squared_differences`.
OUTPUT:
- All the possible plaintext sequences corresponding to the ciphertext ``C``. This method effectively uses all the possible keys in this affine cryptosystem to decrypt ``C``. The method is also referred to as exhaustive key search. The output is a dictionary of key, candidate decipherment pairs.
EXAMPLES:
Cryptanalyze using all possible keys with the option ``ranking="none"``::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 7) sage: P = A.encoding("Linear"); P LINEAR sage: C = A.enciphering(a, b, P) sage: L = A.brute_force(C) sage: sorted(L.items())[:26] # display 26 candidate decipherments <BLANKLINE> [((1, 0), OFUTHG), ((1, 1), NETSGF), ((1, 2), MDSRFE), ((1, 3), LCRQED), ((1, 4), KBQPDC), ((1, 5), JAPOCB), ((1, 6), IZONBA), ((1, 7), HYNMAZ), ((1, 8), GXMLZY), ((1, 9), FWLKYX), ((1, 10), EVKJXW), ((1, 11), DUJIWV), ((1, 12), CTIHVU), ((1, 13), BSHGUT), ((1, 14), ARGFTS), ((1, 15), ZQFESR), ((1, 16), YPEDRQ), ((1, 17), XODCQP), ((1, 18), WNCBPO), ((1, 19), VMBAON), ((1, 20), ULAZNM), ((1, 21), TKZYML), ((1, 22), SJYXLK), ((1, 23), RIXWKJ), ((1, 24), QHWVJI), ((1, 25), PGVUIH)]
Use the chi-square ranking function, i.e. ``ranking="chisquare"``::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 7) sage: P = A.encoding("Linear functions for encrypting and decrypting."); P LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING sage: C = A.enciphering(a, b, P) sage: Rank = A.brute_force(C, ranking="chisquare") sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((3, 7), LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING), ((23, 25), VYTCGPBMTENYSTOBSPCTEPIRNYTAGTDDCEPIRNYTA), ((1, 12), CTIHVUKDIBATLIXKLUHIBUPOATINVIEEHBUPOATIN), ((11, 15), HSRYELDAROVSWRQDWLYROLUBVSRIERTTYOLUBVSRI), ((25, 1), NWHIUVFMHOPWEHSFEVIHOVABPWHCUHLLIOVABPWHC), ((25, 7), TCNOABLSNUVCKNYLKBONUBGHVCNIANRROUBGHVCNI), ((15, 4), SHIBVOWZILEHDIJWDOBILOFYEHIRVIGGBLOFYEHIR), ((15, 23), PEFYSLTWFIBEAFGTALYFILCVBEFOSFDDYILCVBEFO), ((7, 10), IDUFHSYXUTEDNULYNSFUTSVGEDURHUMMFTSVGEDUR), ((19, 22), QVETRGABEFUVLENALGTEFGDSUVEHREMMTFGDSUVEH)]
Use the squared differences ranking function, i.e. ``ranking="squared_differences"``::
sage: Rank = A.brute_force(C, ranking="squared_differences") sage: Rank[:10] # display only the top 10 candidate keys <BLANKLINE> [((3, 7), LINEARFUNCTIONSFORENCRYPTINGANDDECRYPTING), ((23, 6), GJENRAMXEPYJDEZMDANEPATCYJELREOONPATCYJEL), ((23, 25), VYTCGPBMTENYSTOBSPCTEPIRNYTAGTDDCEPIRNYTA), ((19, 22), QVETRGABEFUVLENALGTEFGDSUVEHREMMTFGDSUVEH), ((19, 9), DIRGETNORSHIYRANYTGRSTQFHIRUERZZGSTQFHIRU), ((23, 18), KNIRVEQBITCNHIDQHERITEXGCNIPVISSRTEXGCNIP), ((17, 16), GHORBEIDOJMHFOVIFEROJETWMHOZBOAARJETWMHOZ), ((21, 14), AHEZRMOFEVQHTEBOTMZEVMNIQHEDREKKZVMNIQHED), ((1, 12), CTIHVUKDIBATLIXKLUHIBUPOATINVIEEHBUPOATIN), ((7, 18), SNEPRCIHEDONXEVIXCPEDCFQONEBREWWPDCFQONEB)]
TESTS:
Currently, the binary number system is not supported as an alphabet of this affine cryptosystem::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: BinStr = BinaryStrings() sage: C = BinStr.encoding("abc") sage: A.brute_force(C) Traceback (most recent call last): ... TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
Nor are the octal, hexadecimal, and radix-64 number systems supported::
sage: OctStr = OctalStrings() sage: C = OctStr([1, 2, 3]) sage: A.brute_force(C) Traceback (most recent call last): ... TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem. sage: HexStr = HexadecimalStrings() sage: C = HexStr.encoding("abc") sage: A.brute_force(C) Traceback (most recent call last): ... TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem. sage: RadStr = Radix64Strings() sage: C = RadStr([1, 2, 3]) sage: A.brute_force(C) Traceback (most recent call last): ... TypeError: Ciphertext must be encoded using one of the supported cipher domains of this affine cryptosystem.
Only the chi-square and squared-differences ranking functions are currently supported. The keyword ``ranking`` must take on either of the values ``"none"``, ``"chisquare"`` or ``"squared_differences"``::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 7) sage: P = A.encoding("Linear") sage: C = A.enciphering(a, b, P) sage: A.brute_force(C, ranking="chi") Traceback (most recent call last): ... ValueError: Keyword 'ranking' must be either 'none', 'chisquare', or 'squared_differences'. sage: A.brute_force(C, ranking="") Traceback (most recent call last): ... ValueError: Keyword 'ranking' must be either 'none', 'chisquare', or 'squared_differences'. """ # Sanity check: ensure that C is encoded using one of the # supported alphabets of this affine cryptosystem.
# Now do the actual task of cryptanalysis by means of exhaustive # key search, also known as the brute force method. Let D be a # dictionary of key/plaintext pairs.
# NOTE: This is a good candidate for loop unrolling and # further optimization. Unless we can justify that this block of # code is a bottleneck on the runtime of the method, we should # leave it as is. for a in self._invertible_A for b in range(self.alphabet_size())]
r""" Decrypt the ciphertext ``C`` with the key ``(a, b)`` using affine cipher decryption.
INPUT:
- ``a, b`` -- a secret key belonging to the key space of this affine cipher. This key must be an element of `\ZZ/n\ZZ \times \ZZ/n\ZZ` such that `\gcd(a,n) = 1` with `n` being the size of the ciphertext and plaintext spaces.
- ``C`` -- a string of ciphertext; possibly an empty string. Characters in this string must be encoded using one of the supported alphabets. See the method :func:`encoding()` for more information.
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES:
Decryption over the capital letters of the English alphabet::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (5, 2) sage: P = A.encoding("Affine functions are linear functions.") sage: C = A.enciphering(a, b, P); C CBBQPWBYPMTQUPOCJWFQPWCJBYPMTQUPO sage: P == A.deciphering(a, b, C) True
The previous example can also be worked through using functional notation::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (5, 2) sage: P = A.encoding("Affine functions are linear functions.") sage: E = A(a, b); E Affine cipher on Free alphabetic string monoid on A-Z sage: C = E(P); C CBBQPWBYPMTQUPOCJWFQPWCJBYPMTQUPO sage: aInv, bInv = A.inverse_key(a, b) sage: D = A(aInv, bInv); D Affine cipher on Free alphabetic string monoid on A-Z sage: D(C) == P True
If the ciphertext is an empty string, then the plaintext is also an empty string regardless of the value of the secret key::
sage: a, b = A.random_key() sage: A.deciphering(a, b, A.encoding("")) <BLANKLINE> sage: A.deciphering(a, b, A.encoding(" ")) <BLANKLINE>
TESTS:
The key must be an ordered pair `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` with `n` being the size of the plaintext and ciphertext spaces. Furthermore, `a` must be relatively prime to `n`, i.e. `\gcd(a,n) = 1`::
sage: A.deciphering(2, 6, P) Traceback (most recent call last): ... ValueError: (a, b) = (2, 6) is outside the range of acceptable values for a key of this affine cipher. """
r""" Encrypt the plaintext ``P`` with the key ``(a, b)`` using affine cipher encryption.
INPUT:
- ``a, b`` -- a secret key belonging to the key space of this affine cipher. This key must be an element of `\ZZ/n\ZZ \times \ZZ/n\ZZ` such that `\gcd(a,n) = 1` with `n` being the size of the ciphertext and plaintext spaces.
- ``P`` -- a string of plaintext; possibly an empty string. Characters in this string must be encoded using one of the supported alphabets. See the method :func:`encoding()` for more information.
OUTPUT:
- The ciphertext corresponding to the plaintext ``P``.
EXAMPLES:
Encryption over the capital letters of the English alphabet::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 6) sage: P = A.encoding("Affine ciphers work with linear functions.") sage: A.enciphering(a, b, P) GVVETSMEZBSFIUWFKUELBNETSGFVOTMLEWTI
Now work through the previous example using functional notation::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (3, 6) sage: P = A.encoding("Affine ciphers work with linear functions.") sage: E = A(a, b); E Affine cipher on Free alphabetic string monoid on A-Z sage: E(P) GVVETSMEZBSFIUWFKUELBNETSGFVOTMLEWTI
If the plaintext is an empty string, then the ciphertext is also an empty string regardless of the value of the secret key::
sage: a, b = A.random_key() sage: A.enciphering(a, b, A.encoding("")) <BLANKLINE> sage: A.enciphering(a, b, A.encoding(" ")) <BLANKLINE>
TESTS:
The key must be an ordered pair `(a,b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` with `n` being the size of the plaintext and ciphertext spaces. Furthermore, `a` must be relatively prime to `n`, i.e. `\gcd(a,n) = 1`::
sage: A.enciphering(2, 6, P) Traceback (most recent call last): ... ValueError: (a, b) = (2, 6) is outside the range of acceptable values for a key of this affine cryptosystem. """
r""" The encoding of the string ``S`` over the string monoid of this affine cipher. For example, if the string monoid of this cryptosystem is :class:`AlphabeticStringMonoid <sage.monoids.string_monoid.AlphabeticStringMonoid>`, then the encoding of ``S`` would be its upper-case equivalent stripped of all non-alphabetic characters. Only the following alphabet is supported for the affine cipher:
- capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`
INPUT:
- ``S`` -- a string, possibly empty.
OUTPUT:
- The encoding of ``S`` over the string monoid of this cryptosystem. If ``S`` is an empty string, return an empty string.
EXAMPLES:
Encoding over the upper-case letters of the English alphabet::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A.encoding("Affine cipher over capital letters of the English alphabet.") AFFINECIPHEROVERCAPITALLETTERSOFTHEENGLISHALPHABET
The argument ``S`` can be an empty string, in which case an empty string is returned::
sage: AffineCryptosystem(AlphabeticStrings()).encoding("") <BLANKLINE> """ try: return D.encoding(S) except Exception: raise TypeError("Argument S = %s does not encode in the cipher domain" % S)
r""" The inverse key corresponding to the secret key `(a,b)`. If `p` is a plaintext character so that `p \in \ZZ/n\ZZ` and `n` is the alphabet size, then the ciphertext `c` corresponding to `p` is
.. MATH::
c \equiv ap + b \pmod{n}
As `(a,b)` is a key, then the multiplicative inverse `a^{-1}` exists and the original plaintext can be recovered as follows
.. MATH::
p \equiv a^{-1} (c - b) \pmod{n} \equiv a^{-1}c + a^{-1}(-b) \pmod{n}
Therefore the ordered pair `(a^{-1}, -ba^{-1})` is the inverse key corresponding to `(a,b)`.
INPUT:
- ``a, b`` -- a secret key for this affine cipher. The ordered pair `(a,b)` must be an element of `\ZZ/n\ZZ \times \ZZ/n\ZZ` such that `\gcd(a,n) = 1`.
OUTPUT:
- The inverse key `(a^{-1}, -ba^{-1})` corresponding to `(a,b)`.
EXAMPLES::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: a, b = (1, 2) sage: A.inverse_key(a, b) (1, 24) sage: A.inverse_key(3, 2) (9, 8)
Suppose that the plaintext and ciphertext spaces are the capital letters of the English alphabet so that `n = 26`. If `\varphi(n)` is the Euler phi function of `n`, then there are `\varphi(n)` integers `0 \leq a < n` that are relatively prime to `n`. For the capital letters of the English alphabet, there are 12 such integers relatively prime to `n`::
sage: euler_phi(A.alphabet_size()) 12
And here is a list of those integers::
sage: n = A.alphabet_size() sage: L = [i for i in range(n) if gcd(i, n) == 1]; L [1, 3, 5, 7, 9, 11, 15, 17, 19, 21, 23, 25]
Then a secret key `(a,b)` of this shift cryptosystem is such that `a` is an element of the list ``L`` in the last example. Any inverse key `(A, B)` corresponding to `(a,b)` is such that `A` is also in the list ``L`` above::
sage: a, b = (3, 9) sage: a in L True sage: aInv, bInv = A.inverse_key(a, b) sage: aInv, bInv (9, 23) sage: aInv in L True
TESTS:
Any ordered pair of the form `(0, b)` for any integer `b` cannot be a secret key of this affine cipher. Hence `(0, b)` does not have a corresponding inverse key::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A.inverse_key(0, 1) Traceback (most recent call last): ... ValueError: (a, b) = (0, 1) is outside the range of acceptable values for a key of this affine cipher. """
r""" Generate a random key within the key space of this affine cipher. The generated secret key is an ordered pair `(a, b) \in \ZZ/n\ZZ \times \ZZ/n\ZZ` with `n` being the size of the cipher domain and `\gcd(a, n) = 1`. Let `\varphi(n)` denote the Euler phi function of `n`. Then the affine cipher has `n \cdot \varphi(n)` possible keys (see page 10 of [Sti2006]_).
OUTPUT:
- A random key within the key space of this affine cryptosystem. The output key is an ordered pair `(a,b)`.
EXAMPLES::
sage: A = AffineCryptosystem(AlphabeticStrings()) sage: A.random_key() # random (17, 25)
If `(a,b)` is a secret key and `n` is the size of the plaintext and ciphertext alphabets, then `\gcd(a, n) = 1`::
sage: a, b = A.random_key() sage: n = A.alphabet_size() sage: gcd(a, n) 1 """ # Return a random element in ZZ/nZZ x ZZ/nZZ where n is the number # of elements in the plaintext/ciphertext alphabet.
""" Create a Hill cryptosystem defined by the `m` x `m` matrix space over `\ZZ / N \ZZ`, where `N` is the alphabet size of the string monoid ``S``.
INPUT:
- ``S`` - a string monoid over some alphabet
- ``m`` - integer `> 0`; the block length of matrices that specify block permutations
OUTPUT:
- A Hill cryptosystem of block length ``m`` over the alphabet ``S``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = HillCryptosystem(S,3) sage: E Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3 sage: R = IntegerModRing(26) sage: M = MatrixSpace(R,3,3) sage: A = M([[1,0,1],[0,1,1],[2,2,3]]) sage: A [1 0 1] [0 1 1] [2 2 3] sage: e = E(A) sage: e Hill cipher on Free alphabetic string monoid on A-Z of block length 3 sage: e(S("LAMAISONBLANCHE")) JYVKSKQPELAYKPV
TESTS::
sage: S = AlphabeticStrings() sage: E = HillCryptosystem(S,3) sage: E == loads(dumps(E)) True """
""" See ``HillCryptosystem`` for full documentation.
Create a Hill cryptosystem defined by the `m` x `m` matrix space over `\ZZ / N \ZZ`, where `N` is the alphabet size of the string monoid ``S``.
INPUT:
- ``S`` - a string monoid over some alphabet
- ``m`` - integer `> 0`; the block length of matrices that specify block permutations
OUTPUT:
- A Hill cryptosystem of block length ``m`` over the alphabet ``S``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = HillCryptosystem(S,3) sage: E Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3 """ raise TypeError("S (= %s) must be a string monoid." % S)
""" Create a Hill cipher.
INPUT:
- ``A`` - a matrix which specifies a block permutation
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = HillCryptosystem(S,3) sage: E Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3 sage: M = E.key_space() sage: A = M([[1,0,1],[0,1,1],[2,2,3]]) sage: A [1 0 1] [0 1 1] [2 2 3] sage: e = E(A) sage: e Hill cipher on Free alphabetic string monoid on A-Z of block length 3 sage: m = S("LAMAISONBLANCHE") sage: e(m) JYVKSKQPELAYKPV sage: c = e.inverse() sage: c(e(m)) LAMAISONBLANCHE """ try: A = M(A) except Exception: raise TypeError("A (= %s) must specify a square matrix of degree %s." % (A, m))
""" Return a string representation of self.
EXAMPLES::
sage: A = AlphabeticStrings() sage: H = HillCryptosystem(A, 3) sage: H Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3 sage: H._repr_() 'Hill cryptosystem on Free alphabetic string monoid on A-Z of block length 3' """ self.cipher_domain(), self.block_length())
""" The row or column dimension of a matrix specifying a block permutation. Encryption and decryption keys of a Hill cipher are square matrices, i.e. the row and column dimensions of an encryption or decryption key are the same. This row/column dimension is referred to as the *block length*.
OUTPUT:
- The block length of an encryption/decryption key.
EXAMPLES::
sage: A = AlphabeticStrings() sage: n = randint(1, A.ngens() - 1) sage: H = HillCryptosystem(A, n) sage: H.block_length() == n True """
""" A random key within the key space of this Hill cipher. That is, generate a random `m` x `m` matrix to be used as a block permutation, where `m` is the block length of this Hill cipher. If `n` is the size of the cryptosystem alphabet, then there are `n^{m^2}` possible keys. However the number of valid keys, i.e. invertible `m` x `m` square matrices, is smaller than `n^{m^2}`.
OUTPUT:
- A random key within the key space of this Hill cipher.
EXAMPLES::
sage: A = AlphabeticStrings() sage: n = 3 sage: H = HillCryptosystem(A, n) sage: K = H.random_key() sage: Ki = H.inverse_key(K) sage: M = "LAMAISONBLANCHE" sage: e = H(K) sage: d = H(Ki) sage: d(e(A(M))) == A(M) True """
""" The inverse key corresponding to the key ``A``.
INPUT:
- ``A`` - an invertible matrix of the key space of this Hill cipher
OUTPUT:
- The inverse matrix of ``A``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = HillCryptosystem(S,3) sage: A = E.random_key() sage: B = E.inverse_key(A) sage: M = S("LAMAISONBLANCHE") sage: e = E(A) sage: c = E(B) sage: c(e(M)) LAMAISONBLANCHE """ raise TypeError("A (= %s) must be a matrix in the key space of %s." % (A, self)) raise ValueError("Argument:\n\n%s\n\nis not invertible." % (A))
""" The encoding of the string ``M`` over the string monoid of this Hill cipher. For example, if the string monoid of this Hill cipher is :class:`AlphabeticStringMonoid`, then the encoding of ``M`` would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
- ``M`` - a string, possibly empty
OUTPUT:
- The encoding of ``M`` over the string monoid of this Hill cipher.
EXAMPLES::
sage: M = "The matrix cipher by Lester S. Hill." sage: A = AlphabeticStrings() sage: H = HillCryptosystem(A, 7) sage: H.encoding(M) == A.encoding(M) True """ try: return S.encoding(M) except Exception: raise TypeError("Argument M = %s does not encode in the cipher domain" % M)
""" Decrypt the ciphertext ``C`` using the key ``A``.
INPUT:
- ``A`` - a key within the key space of this Hill cipher
- ``C`` - a string (possibly empty) over the string monoid of this Hill cipher
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES::
sage: H = HillCryptosystem(AlphabeticStrings(), 3) sage: K = H.random_key() sage: M = H.encoding("Good day, mate! How ya going?") sage: H.deciphering(K, H.enciphering(K, M)) == M True """ # TODO: some type checking that A is invertible hence a valid key
""" Encrypt the plaintext ``M`` using the key ``A``.
INPUT:
- ``A`` - a key within the key space of this Hill cipher
- ``M`` - a string (possibly empty) over the string monoid of this Hill cipher.
OUTPUT:
- The ciphertext corresponding to the plaintext ``M``.
EXAMPLES::
sage: H = HillCryptosystem(AlphabeticStrings(), 3) sage: K = H.random_key() sage: M = H.encoding("Good day, mate! How ya going?") sage: H.deciphering(K, H.enciphering(K, M)) == M True """ # TODO: some type checking that A is invertible hence a valid key
r""" Create a shift cryptosystem.
Let `A = \{ a_0, a_1, a_2, \dots, a_{n-1} \}` be a non-empty alphabet consisting of `n` unique elements. Define a mapping `f : A \longrightarrow \ZZ/ n\ZZ` from the alphabet `A` to the set `\ZZ / n\ZZ` of integers modulo `n`, given by `f(a_i) = i`. Thus we can identify each element of the alphabet `A` with a unique integer `0 \leq i < n`. A key of the shift cipher is an integer `0 \leq k < n`. Therefore the key space is `\ZZ / n\ZZ`. Since we assume that `A` does not have repeated elements, the mapping `f : A \longrightarrow \ZZ/ n\ZZ` is bijective. Encryption works by moving along the alphabet by `k` positions, with wrap around. Decryption reverses the process by moving backwards by `k` positions, with wrap around. More generally, let `k` be a secret key, i.e. an element of the key space, and let `p` be a plaintext character and consequently `p \in \ZZ / n\ZZ`. Then the ciphertext character `c` corresponding to `p` is given by
.. MATH::
c \equiv p + k \pmod{n}
Similarly, given a ciphertext character `c \in \ZZ / n\ZZ` and a secret key `k`, we can recover the corresponding plaintext character as follows:
.. MATH::
p \equiv c - k \pmod{n}
Use the bijection `f : A \longrightarrow \ZZ/ n\ZZ` to convert `c` and `p` back to elements of the alphabet `A`. Currently, the following alphabets are supported for the shift cipher:
- capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`
- the alphabet consisting of the hexadecimal number system as implemented in :func:`HexadecimalStrings() <sage.monoids.string_monoid.HexadecimalStrings>`
- the alphabet consisting of the binary number system as implemented in :func:`BinaryStrings() <sage.monoids.string_monoid.BinaryStrings>`
EXAMPLES:
Some examples illustrating encryption and decryption over various alphabets. Here is an example over the upper-case letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()); S Shift cryptosystem on Free alphabetic string monoid on A-Z sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.") sage: P THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER sage: K = 7 sage: C = S.enciphering(K, P); C AOLZOPMAJYFWAVZFZALTNLULYHSPGLZAOLJHLZHYJPWOLY sage: S.deciphering(K, C) THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER sage: S.deciphering(K, C) == P True
The previous example can also be done as follows::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.") sage: K = 7 sage: E = S(K); E Shift cipher on Free alphabetic string monoid on A-Z sage: C = E(P); C AOLZOPMAJYFWAVZFZALTNLULYHSPGLZAOLJHLZHYJPWOLY sage: D = S(S.inverse_key(K)); D Shift cipher on Free alphabetic string monoid on A-Z sage: D(C) == P True sage: D(C) == P == D(E(P)) True
Over the hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()); S Shift cryptosystem on Free hexadecimal string monoid sage: P = S.encoding("Encryption & decryption shifts along the alphabet."); P 456e6372797074696f6e20262064656372797074696f6e2073686966747320616c6f6e672074686520616c7068616265742e sage: K = 5 sage: C = S.enciphering(K, P); C 9ab3b8c7cec5c9beb4b3757b75b9bab8c7cec5c9beb4b375c8bdbebbc9c875b6b1b4b3bc75c9bdba75b6b1c5bdb6b7bac973 sage: S.deciphering(K, C) 456e6372797074696f6e20262064656372797074696f6e2073686966747320616c6f6e672074686520616c7068616265742e sage: S.deciphering(K, C) == P True
And over the binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()); S Shift cryptosystem on Free binary string monoid sage: P = S.encoding("The binary alphabet is very insecure."); P 01010100011010000110010100100000011000100110100101101110011000010111001001111001001000000110000101101100011100000110100001100001011000100110010101110100001000000110100101110011001000000111011001100101011100100111100100100000011010010110111001110011011001010110001101110101011100100110010100101110 sage: K = 1 sage: C = S.enciphering(K, P); C 10101011100101111001101011011111100111011001011010010001100111101000110110000110110111111001111010010011100011111001011110011110100111011001101010001011110111111001011010001100110111111000100110011010100011011000011011011111100101101001000110001100100110101001110010001010100011011001101011010001 sage: S.deciphering(K, C) 01010100011010000110010100100000011000100110100101101110011000010111001001111001001000000110000101101100011100000110100001100001011000100110010101110100001000000110100101110011001000000111011001100101011100100111100100100000011010010110111001110011011001010110001101110101011100100110010100101110 sage: S.deciphering(K, C) == P True
A shift cryptosystem with key `k = 3` is commonly referred to as the Caesar cipher. Create a Caesar cipher over the upper-case letters of the English alphabet::
sage: caesar = ShiftCryptosystem(AlphabeticStrings()) sage: K = 3 sage: P = caesar.encoding("abcdef"); P ABCDEF sage: C = caesar.enciphering(K, P); C DEFGHI sage: caesar.deciphering(K, C) == P True
Generate a random key for encryption and decryption::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shift cipher with a random key.") sage: K = S.random_key() sage: C = S.enciphering(K, P) sage: S.deciphering(K, C) == P True
Decrypting with the key ``K`` is equivalent to encrypting with its corresponding inverse key::
sage: S.enciphering(S.inverse_key(K), C) == P True
TESTS:
Currently, the octal number system is not supported as an alphabet for this shift cryptosystem::
sage: ShiftCryptosystem(OctalStrings()) Traceback (most recent call last): ... TypeError: A (= Free octal string monoid) is not supported as a cipher domain of this shift cryptosystem.
Nor is the radix-64 number system supported::
sage: ShiftCryptosystem(Radix64Strings()) Traceback (most recent call last): ... TypeError: A (= Free radix 64 string monoid) is not supported as a cipher domain of this shift cryptosystem.
Testing of dumping and loading objects::
sage: SA = ShiftCryptosystem(AlphabeticStrings()) sage: SA == loads(dumps(SA)) True sage: SH = ShiftCryptosystem(HexadecimalStrings()) sage: SH == loads(dumps(SH)) True sage: SB = ShiftCryptosystem(BinaryStrings()) sage: SB == loads(dumps(SB)) True
The key ``K`` must satisfy the inequality `0 \leq K < n` with `n` being the size of the plaintext, ciphertext, and key spaces. For the shift cryptosystem, all these spaces are the same alphabet. This inequality must be satisfied for each of the supported alphabets. The capital letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: S(2 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=28) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-2) Traceback (most recent call last): ... ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem.
The hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: S(1 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=17) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-1) Traceback (most recent call last): ... ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: S(1 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=3) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-2) Traceback (most recent call last): ... ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem. """
r""" See ``ShiftCryptosystem`` for full documentation.
Create a shift cryptosystem defined over the alphabet ``A``.
INPUT:
- ``A`` -- a string monoid over some alphabet; this is the non-empty alphabet over which the plaintext and ciphertext spaces are defined.
OUTPUT:
- A shift cryptosystem over the alphabet ``A``.
EXAMPLES::
sage: S = ShiftCryptosystem(AlphabeticStrings()); S Shift cryptosystem on Free alphabetic string monoid on A-Z sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.") sage: P THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER sage: K = 7 sage: C = S.enciphering(K, P); C AOLZOPMAJYFWAVZFZALTNLULYHSPGLZAOLJHLZHYJPWOLY sage: S.deciphering(K, C) THESHIFTCRYPTOSYSTEMGENERALIZESTHECAESARCIPHER sage: S.deciphering(K, C) == P True """ # NOTE: the code here is very similar to that in the method # rank_by_chi_square() of the class AffineCryptosystem. The most # significant change in the code below is in how the secret key k # is processed.
# sanity check AlphabeticStringMonoid, BinaryStringMonoid, HexadecimalStringMonoid) BinaryStringMonoid, HexadecimalStringMonoid )): # Initialize the shift cryptosystem with the plaintext, ciphertext, # and key spaces.
r""" Create a shift cipher with key ``K``.
INPUT:
- ``K`` -- a secret key; this key is used for both encryption and decryption. For the shift cryptosystem whose plaintext and ciphertext spaces are `A`, a key is any integer `k` such that `0 \leq k < n` where `n` is the size or cardinality of the set `A`.
OUTPUT:
- A shift cipher with secret key ``K``.
EXAMPLES::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shifting sand."); P SHIFTINGSAND sage: K = 3 sage: E = S(K); E Shift cipher on Free alphabetic string monoid on A-Z sage: E(P) VKLIWLQJVDQG sage: D = S(S.inverse_key(K)); D Shift cipher on Free alphabetic string monoid on A-Z sage: D(E(P)) SHIFTINGSAND
TESTS:
The key ``K`` must satisfy the inequality `0 \leq K < n` with `n` being the size of the plaintext, ciphertext, and key spaces. For the shift cryptosystem, all these spaces are the same alphabet. This inequality must be satisfied for each of the supported alphabets. The capital letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: S(2 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=28) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-2) Traceback (most recent call last): ... ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem.
The hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: S(1 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=17) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-1) Traceback (most recent call last): ... ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: S(1 + S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=3) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S(-2) Traceback (most recent call last): ... ValueError: K (=-2) is outside the range of acceptable values for a key of this shift cryptosystem. """ # Sanity check: the key K must satisfy the inequality # 0 <= K < n with n being the size of the plaintext, ciphertext, and # key spaces. For the shift cryptosystem, all these spaces are the # same alphabet. # from sage.rings.finite_rings.integer_mod import Mod # return ShiftCipher(self, Mod(K, self.alphabet_size()).lift()) else:
r""" Return the string representation of ``self``.
EXAMPLES::
sage: ShiftCryptosystem(AlphabeticStrings()) Shift cryptosystem on Free alphabetic string monoid on A-Z sage: ShiftCryptosystem(HexadecimalStrings()) Shift cryptosystem on Free hexadecimal string monoid sage: ShiftCryptosystem(BinaryStrings()) Shift cryptosystem on Free binary string monoid """ # The shift cipher has the plaintext and ciphertext spaces defined # over the same non-empty alphabet. The cipher domain is the same # as the alphabet used for the plaintext and ciphertext spaces.
r""" Use the chi-square statistic to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet `A` consisting of `n` elements, and let `C` be a ciphertext encoded using elements of `A`. The plaintext `P` corresponding to `C` is also encoded using elements of `A`. Let `M` be a candidate decipherment of `C`, i.e. `M` is the result of attempting to decrypt `C` using a key `k \in \ZZ/n\ZZ` which is not necessarily the same key used to encrypt `P`. Suppose `F_A(e)` is the characteristic frequency probability of `e \in A` and let `F_M(e)` be the message frequency probability with respect to `M`. The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of `M` provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability `F_A(e)` as the expected probability, while the message frequency probability `F_M(e)` is the observed probability. If `M` is of length `L`, then the observed frequency of `e \in A` is
.. MATH::
O_M(e) = F_M(e) \cdot L
and the expected frequency of `e \in A` is
.. MATH::
E_A(e) = F_A(e) \cdot L
The chi-square rank `R_{\chi^2}(M)` of `M` corresponding to a key `k \in \ZZ/n\ZZ` is given by
.. MATH::
R_{\chi^2}(M) = \sum_{e \in A} \frac {\big( O_M(e) - E_A(e) \big)^2} {E_A(e)}
Cryptanalysis by exhaustive key search produces a candidate decipherment `M_{k}` for each possible key `k \in \ZZ/n\ZZ`. For a set `D = \big\{M_{k_1}, M_{k_2}, \dots, M_{k_r} \big\}` of all candidate decipherments corresponding to a ciphertext `C`, the smaller is the rank `R_{\chi^2}(M_{k_i})` the more likely that `k_i` is the secret key. This key ranking method is based on the Pearson chi-square test [PearsonTest]_.
INPUT:
- ``C`` -- The ciphertext, a non-empty string. The ciphertext must be encoded using the upper-case letters of the English alphabet.
- ``pdict`` -- A dictionary of key, possible plaintext pairs. This should be the output of :func:`brute_force` with ``ranking="none"``.
OUTPUT:
- A list ranking the most likely keys first. Each element of the list is a tuple of key, possible plaintext pairs.
EXAMPLES:
Use the chi-square statistic to rank all possible keys and their corresponding decipherment::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shi."); P SHI sage: K = 5 sage: C = S.enciphering(K, P) sage: Pdict = S.brute_force(C) sage: S.rank_by_chi_square(C, Pdict) <BLANKLINE> [(9, ODE), (5, SHI), (20, DST), (19, ETU), (21, CRS), (10, NCD), (25, YNO), (6, RGH), (12, LAB), (8, PEF), (1, WLM), (11, MBC), (18, FUV), (17, GVW), (2, VKL), (4, TIJ), (3, UJK), (0, XMN), (16, HWX), (15, IXY), (23, APQ), (24, ZOP), (22, BQR), (7, QFG), (13, KZA), (14, JYZ)]
As more ciphertext is available, the reliability of the chi-square ranking function increases::
sage: P = S.encoding("Shift cipher."); P SHIFTCIPHER sage: C = S.enciphering(K, P) sage: Pdict = S.brute_force(C) sage: S.rank_by_chi_square(C, Pdict) <BLANKLINE> [(5, SHIFTCIPHER), (9, ODEBPYELDAN), (18, FUVSGPVCURE), (2, VKLIWFLSKHU), (20, DSTQENTASPC), (19, ETURFOUBTQD), (21, CRSPDMSZROB), (6, RGHESBHOGDQ), (7, QFGDRAGNFCP), (12, LABYMVBIAXK), (17, GVWTHQWDVSF), (24, ZOPMAJPWOLY), (1, WLMJXGMTLIV), (0, XMNKYHNUMJW), (11, MBCZNWCJBYL), (8, PEFCQZFMEBO), (25, YNOLZIOVNKX), (10, NCDAOXDKCZM), (3, UJKHVEKRJGT), (4, TIJGUDJQIFS), (22, BQROCLRYQNA), (16, HWXUIRXEWTG), (15, IXYVJSYFXUH), (14, JYZWKTZGYVI), (13, KZAXLUAHZWJ), (23, APQNBKQXPMZ)]
TESTS:
The ciphertext cannot be an empty string::
sage: S.rank_by_chi_square("", Pdict) Traceback (most recent call last): ... AttributeError: 'str' object has no attribute 'parent' sage: S.rank_by_chi_square(S.encoding(""), Pdict) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string. sage: S.rank_by_chi_square(S.encoding(" "), Pdict) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`::
sage: H = HexadecimalStrings() sage: S.rank_by_chi_square(H.encoding("shift"), Pdict) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet. sage: B = BinaryStrings() sage: S.rank_by_chi_square(B.encoding("shift"), Pdict) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary ``pdict`` cannot be empty::
sage: S.rank_by_chi_square(C, {}) Traceback (most recent call last): ... KeyError: 0 """ # NOTE: the code here is very similar to that in the method # rank_by_chi_square() of the class AffineCryptosystem. The most # significant change in the code below is in how the secret key k # is processed.
# sanity check
# compute the rank of each key # the alphabet in question # message length # expected frequency tally # the rank R(M, k) of M for each key # observed frequency tally else: # the rank R(M, K) of M with shift key k # Sort in non-decreasing order of squared-differences statistic. It's # possible that two different keys share the same squared-differences # statistic. # In the following line, the value of val is not used at all, making # it redundant to access val in the first place. This line # of code is written with readability in mind.
r""" Use the squared-differences measure to rank all possible keys. Currently, this method only applies to the capital letters of the English alphabet.
ALGORITHM:
Consider a non-empty alphabet `A` consisting of `n` elements, and let `C` be a ciphertext encoded using elements of `A`. The plaintext `P` corresponding to `C` is also encoded using elements of `A`. Let `M` be a candidate decipherment of `C`, i.e. `M` is the result of attempting to decrypt `C` using a key `k \in \ZZ/n\ZZ` which is not necessarily the same key used to encrypt `P`. Suppose `F_A(e)` is the characteristic frequency probability of `e \in A` and let `F_M(e)` be the message frequency probability with respect to `M`. The characteristic frequency probability distribution of an alphabet is the expected frequency probability distribution for that alphabet. The message frequency probability distribution of `M` provides a distribution of the ratio of character occurrences over message length. One can interpret the characteristic frequency probability `F_A(e)` as the expected probability, while the message frequency probability `F_M(e)` is the observed probability. If `M` is of length `L`, then the observed frequency of `e \in A` is
.. MATH::
O_M(e) = F_M(e) \cdot L
and the expected frequency of `e \in A` is
.. MATH::
E_A(e) = F_A(e) \cdot L
The squared-differences, or residual sum of squares, rank `R_{RSS}(M)` of `M` corresponding to a key `k \in \ZZ/n\ZZ` is given by
.. MATH::
R_{RSS}(M) = \sum_{e \in A} \big( O_M(e) - E_A(e) \big)^2
Cryptanalysis by exhaustive key search produces a candidate decipherment `M_{k}` for each possible key `k \in \ZZ/n\ZZ`. For a set `D = \big\{M_{k_1}, M_{k_2}, \dots, M_{k_r} \big\}` of all candidate decipherments corresponding to a ciphertext `C`, the smaller is the rank `R_{RSS}(M_{k_i})` the more likely that `k_i` is the secret key. This key ranking method is based on the residual sum of squares measure [RSS]_.
INPUT:
- ``C`` -- The ciphertext, a non-empty string. The ciphertext must be encoded using the upper-case letters of the English alphabet.
- ``pdict`` -- A dictionary of key, possible plaintext pairs. This should be the output of :func:`brute_force` with ``ranking="none"``.
OUTPUT:
- A list ranking the most likely keys first. Each element of the list is a tuple of key, possible plaintext pairs.
EXAMPLES:
Use the method of squared differences to rank all possible keys and their corresponding decipherment::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shi."); P SHI sage: K = 5 sage: C = S.enciphering(K, P) sage: Pdict = S.brute_force(C) sage: S.rank_by_squared_differences(C, Pdict) <BLANKLINE> [(19, ETU), (9, ODE), (20, DST), (5, SHI), (8, PEF), (4, TIJ), (25, YNO), (21, CRS), (6, RGH), (10, NCD), (12, LAB), (23, APQ), (24, ZOP), (0, XMN), (13, KZA), (15, IXY), (1, WLM), (16, HWX), (22, BQR), (11, MBC), (18, FUV), (2, VKL), (17, GVW), (7, QFG), (3, UJK), (14, JYZ)]
As more ciphertext is available, the reliability of the squared differences ranking function increases::
sage: P = S.encoding("Shift cipher."); P SHIFTCIPHER sage: C = S.enciphering(K, P) sage: Pdict = S.brute_force(C) sage: S.rank_by_squared_differences(C, Pdict) <BLANKLINE> [(20, DSTQENTASPC), (5, SHIFTCIPHER), (9, ODEBPYELDAN), (19, ETURFOUBTQD), (6, RGHESBHOGDQ), (16, HWXUIRXEWTG), (8, PEFCQZFMEBO), (21, CRSPDMSZROB), (22, BQROCLRYQNA), (25, YNOLZIOVNKX), (3, UJKHVEKRJGT), (18, FUVSGPVCURE), (4, TIJGUDJQIFS), (10, NCDAOXDKCZM), (7, QFGDRAGNFCP), (24, ZOPMAJPWOLY), (2, VKLIWFLSKHU), (12, LABYMVBIAXK), (17, GVWTHQWDVSF), (1, WLMJXGMTLIV), (13, KZAXLUAHZWJ), (0, XMNKYHNUMJW), (15, IXYVJSYFXUH), (14, JYZWKTZGYVI), (11, MBCZNWCJBYL), (23, APQNBKQXPMZ)]
TESTS:
The ciphertext cannot be an empty string::
sage: S.rank_by_squared_differences("", Pdict) Traceback (most recent call last): ... AttributeError: 'str' object has no attribute 'parent' sage: S.rank_by_squared_differences(S.encoding(""), Pdict) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string. sage: S.rank_by_squared_differences(S.encoding(" "), Pdict) Traceback (most recent call last): ... ValueError: The ciphertext must be a non-empty string.
The ciphertext must be encoded using the capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`::
sage: H = HexadecimalStrings() sage: S.rank_by_squared_differences(H.encoding("shift"), Pdict) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet. sage: B = BinaryStrings() sage: S.rank_by_squared_differences(B.encoding("shift"), Pdict) Traceback (most recent call last): ... TypeError: The ciphertext must be capital letters of the English alphabet.
The dictionary ``pdict`` cannot be empty::
sage: S.rank_by_squared_differences(C, {}) Traceback (most recent call last): ... KeyError: 0 """ # NOTE: the code in this method is very similar to that in the # method rank_by_chi_square(). The only difference here is the # line that computes the list RMk.
# sanity check AlphabeticStringMonoid, AlphabeticStrings)
# compute the rank of each key # the alphabet in question # message length # expected frequency tally # the rank R(M, k) of M for each key # observed frequency tally else: # the rank R(M, K) of M with shift key k # Sort in non-decreasing order of squared-differences statistic. It's # possible that two different keys share the same squared-differences # statistic. # In the following line, the value of val is not used at all, making # it redundant to access val in the first place. This line # of code is written with readability in mind.
r""" Attempt a brute force cryptanalysis of the ciphertext ``C``.
INPUT:
- ``C`` -- A ciphertext over one of the supported alphabets of this shift cryptosystem. See the class :class:`ShiftCryptosystem` for documentation on the supported alphabets.
- ``ranking`` -- (default ``"none"``) the method to use for ranking all possible keys. If ``ranking="none"``, then do not use any ranking function. The following ranking functions are supported:
- ``"chisquare"`` -- the chi-square ranking function as implemented in the method :func:`rank_by_chi_square`.
- ``"squared_differences"`` -- the squared differences ranking function as implemented in the method :func:`rank_by_squared_differences`.
OUTPUT:
- All the possible plaintext sequences corresponding to the ciphertext ``C``. This method effectively uses all the possible keys in this shift cryptosystem to decrypt ``C``. The method is also referred to as exhaustive key search. The output is a dictionary of key, plaintext pairs.
EXAMPLES:
Cryptanalyze using all possible keys for various alphabets. Over the upper-case letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("The shift cryptosystem generalizes the Caesar cipher.") sage: K = 7 sage: C = S.enciphering(K, P) sage: Dict = S.brute_force(C) sage: for k in range(len(Dict)): ....: if Dict[k] == P: ....: print("key = " + str(k)) key = 7
Over the hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: P = S.encoding("Encryption & decryption shifts along the alphabet.") sage: K = 5 sage: C = S.enciphering(K, P) sage: Dict = S.brute_force(C) sage: for k in range(len(Dict)): ....: if Dict[k] == P: ....: print("key = " + str(k)) key = 5
And over the binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: P = S.encoding("The binary alphabet is very insecure.") sage: K = 1 sage: C = S.enciphering(K, P) sage: Dict = S.brute_force(C) sage: for k in range(len(Dict)): ....: if Dict[k] == P: ....: print("key = " + str(k)) key = 1
Don't use any ranking functions, i.e. ``ranking="none"``::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shifting using modular arithmetic.") sage: K = 8 sage: C = S.enciphering(K, P) sage: pdict = S.brute_force(C) sage: sorted(pdict.items()) <BLANKLINE> [(0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK), (1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ), (2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI), (3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH), (4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG), (5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF), (6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE), (7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD), (8, SHIFTINGUSINGMODULARARITHMETIC), (9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB), (10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA), (11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ), (12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY), (13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX), (14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW), (15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV), (16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU), (17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT), (18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS), (19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR), (20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ), (21, FUVSGVATHFVATZBQHYNENEVGUZRGVP), (22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO), (23, DSTQETYRFDTYRXZOFWLCLCTESXPETN), (24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM), (25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL)]
Use the chi-square ranking function, i.e. ``ranking="chisquare"``::
sage: S.brute_force(C, ranking="chisquare") <BLANKLINE> [(8, SHIFTINGUSINGMODULARARITHMETIC), (14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW), (20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ), (13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX), (1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ), (23, DSTQETYRFDTYRXZOFWLCLCTESXPETN), (10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA), (6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE), (22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO), (15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV), (12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY), (21, FUVSGVATHFVATZBQHYNENEVGUZRGVP), (16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU), (25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL), (9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB), (24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM), (3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH), (5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF), (7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD), (2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI), (18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS), (4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG), (11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ), (19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR), (0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK), (17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT)]
Use the squared differences ranking function, i.e. ``ranking="squared_differences"``::
sage: S.brute_force(C, ranking="squared_differences") <BLANKLINE> [(8, SHIFTINGUSINGMODULARARITHMETIC), (23, DSTQETYRFDTYRXZOFWLCLCTESXPETN), (12, ODEBPEJCQOEJCIKZQHWNWNEPDIAPEY), (2, YNOLZOTMAYOTMSUJARGXGXOZNSKZOI), (9, RGHESHMFTRHMFLNCTKZQZQHSGLDSHB), (7, TIJGUJOHVTJOHNPEVMBSBSJUINFUJD), (21, FUVSGVATHFVATZBQHYNENEVGUZRGVP), (22, ETURFUZSGEUZSYAPGXMDMDUFTYQFUO), (1, ZOPMAPUNBZPUNTVKBSHYHYPAOTLAPJ), (16, KZAXLAFYMKAFYEGVMDSJSJALZEWLAU), (20, GVWTHWBUIGWBUACRIZOFOFWHVASHWQ), (24, CRSPDSXQECSXQWYNEVKBKBSDRWODSM), (14, MBCZNCHAOMCHAGIXOFULULCNBGYNCW), (13, NCDAODIBPNDIBHJYPGVMVMDOCHZODX), (3, XMNKYNSLZXNSLRTIZQFWFWNYMRJYNH), (10, QFGDRGLESQGLEKMBSJYPYPGRFKCRGA), (15, LABYMBGZNLBGZFHWNETKTKBMAFXMBV), (6, UJKHVKPIWUKPIOQFWNCTCTKVJOGVKE), (11, PEFCQFKDRPFKDJLARIXOXOFQEJBQFZ), (25, BQROCRWPDBRWPVXMDUJAJARCQVNCRL), (17, JYZWKZEXLJZEXDFULCRIRIZKYDVKZT), (19, HWXUIXCVJHXCVBDSJAPGPGXIWBTIXR), (4, WLMJXMRKYWMRKQSHYPEVEVMXLQIXMG), (0, APQNBQVOCAQVOUWLCTIZIZQBPUMBQK), (18, IXYVJYDWKIYDWCETKBQHQHYJXCUJYS), (5, VKLIWLQJXVLQJPRGXODUDULWKPHWLF)]
TESTS:
Currently, the octal number system is not supported as an alphabet for this shift cryptosystem::
sage: SA = ShiftCryptosystem(AlphabeticStrings()) sage: OctStr = OctalStrings() sage: C = OctStr([1, 2, 3]) sage: SA.brute_force(C) Traceback (most recent call last): ... TypeError: ciphertext must be encoded using one of the supported cipher domains of this shift cryptosystem.
Nor is the radix-64 alphabet supported::
sage: Rad64 = Radix64Strings() sage: C = Rad64([1, 2, 3]) sage: SA.brute_force(C) Traceback (most recent call last): ... TypeError: ciphertext must be encoded using one of the supported cipher domains of this shift cryptosystem. """ # Sanity check: ensure that C is encoded using one of the # supported alphabets of this shift cryptosystem. AlphabeticStringMonoid, BinaryStringMonoid, HexadecimalStringMonoid) AlphabeticStringMonoid, BinaryStringMonoid, HexadecimalStringMonoid)): raise ValueError("Keyword 'ranking' must be either 'none', 'chisquare', or 'squared_differences'.")
# Now do the actual task of cryptanalysis by means of exhaustive key # search, also known as the brute force method. # let D be a dictionary of key/plaintext pairs
# NOTE: This loop is a good candidate for loop unrolling. Unless we # can justify that this block of code is a bottleneck on the runtime # of the method, we should leave it as is. For the alphabets that # are supported by this shift cryptosystem, it can be a waste of # time optimizing the code when the largest alphabet size is less # than 100.
r""" Decrypt the ciphertext ``C`` with the key ``K`` using shift cipher decryption.
INPUT:
- ``K`` -- a secret key; a key belonging to the key space of this shift cipher. This key is an integer `k` satisfying the inequality `0 \leq k < n`, where `n` is the size of the cipher domain.
- ``C`` -- a string of ciphertext; possibly an empty string. Characters in this string must be encoded using one of the supported alphabets. See the method :func:`encoding()` for more information.
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES:
Let's perform decryption over the supported alphabets. Here is decryption over the capital letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Stop shifting me."); P STOPSHIFTINGME sage: K = 13 sage: C = S.enciphering(K, P); C FGBCFUVSGVATZR sage: S.deciphering(K, C) == P True
Decryption over the hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: P = S.encoding("Shift me now."); P 5368696674206d65206e6f772e sage: K = 7 sage: C = S.enciphering(K, P); C cadfd0ddeb97d4dc97d5d6ee95 sage: S.deciphering(K, C) == P True
Decryption over the binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: P = S.encoding("OK, enough shifting."); P 0100111101001011001011000010000001100101011011100110111101110101011001110110100000100000011100110110100001101001011001100111010001101001011011100110011100101110 sage: K = 1 sage: C = S.enciphering(K, P); C 1011000010110100110100111101111110011010100100011001000010001010100110001001011111011111100011001001011110010110100110011000101110010110100100011001100011010001 sage: S.deciphering(K, C) == P True """
r""" Encrypt the plaintext ``P`` with the key ``K`` using shift cipher encryption.
INPUT:
- ``K`` -- a key belonging to the key space of this shift cipher. This key is an integer `k` satisfying the inequality `0 \leq k < n`, where `n` is the size of the cipher domain.
- ``P`` -- a string of plaintext; possibly an empty string. Characters in this string must be encoded using one of the supported alphabets. See the method :func:`encoding()` for more information.
OUTPUT:
- The ciphertext corresponding to the plaintext ``P``.
EXAMPLES:
Let's perform encryption over the supported alphabets. Here is encryption over the capital letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: P = S.encoding("Shift your gear."); P SHIFTYOURGEAR sage: K = 3 sage: S.enciphering(K, P) VKLIWBRXUJHDU
Encryption over the hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: P = S.encoding("Capitalize with the shift key."); P 4361706974616c697a65207769746820746865207368696674206b65792e sage: K = 5 sage: S.enciphering(K, P) 98b6c5bec9b6b1becfba75ccbec9bd75c9bdba75c8bdbebbc975b0bace73
Encryption over the binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: P = S.encoding("Don't shift."); P 010001000110111101101110001001110111010000100000011100110110100001101001011001100111010000101110 sage: K = 1 sage: S.enciphering(K, P) 101110111001000010010001110110001000101111011111100011001001011110010110100110011000101111010001 """
r""" The encoding of the string ``S`` over the string monoid of this shift cipher. For example, if the string monoid of this cryptosystem is :class:`AlphabeticStringMonoid <sage.monoids.string_monoid.AlphabeticStringMonoid>`, then the encoding of ``S`` would be its upper-case equivalent stripped of all non-alphabetic characters. The following alphabets are supported for the shift cipher:
- capital letters of the English alphabet as implemented in :func:`AlphabeticStrings() <sage.monoids.string_monoid.AlphabeticStrings>`
- the alphabet consisting of the hexadecimal number system as implemented in :func:`HexadecimalStrings() <sage.monoids.string_monoid.HexadecimalStrings>`
- the alphabet consisting of the binary number system as implemented in :func:`BinaryStrings() <sage.monoids.string_monoid.BinaryStrings>`
INPUT:
- ``S`` -- a string, possibly empty.
OUTPUT:
- The encoding of ``S`` over the string monoid of this cryptosystem. If ``S`` is an empty string, return an empty string.
EXAMPLES:
Encoding over the upper-case letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: S.encoding("Shift cipher on capital letters of the English alphabet.") SHIFTCIPHERONCAPITALLETTERSOFTHEENGLISHALPHABET
Encoding over the binary system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: S.encoding("Binary") 010000100110100101101110011000010111001001111001
Encoding over the hexadecimal system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: S.encoding("Over hexadecimal system.") 4f7665722068657861646563696d616c2073797374656d2e
The argument ``S`` can be an empty string, in which case an empty string is returned::
sage: ShiftCryptosystem(AlphabeticStrings()).encoding("") <BLANKLINE> sage: ShiftCryptosystem(HexadecimalStrings()).encoding("") <BLANKLINE> sage: ShiftCryptosystem(BinaryStrings()).encoding("") <BLANKLINE> """ except Exception: raise TypeError("Argument S = %s does not encode in the cipher domain" % S)
r""" The inverse key corresponding to the key ``K``. For the shift cipher, the inverse key corresponding to ``K`` is `-K \bmod n`, where `n > 0` is the size of the cipher domain, i.e. the plaintext/ciphertext space. A key `k` of the shift cipher is an integer `0 \leq k < n`. The key `k = 0` has no effect on either the plaintext or the ciphertext.
INPUT:
- ``K`` -- a key for this shift cipher. This must be an integer `k` such that `0 \leq k < n`, where `n` is the size of the cipher domain.
OUTPUT:
- The inverse key corresponding to ``K``.
EXAMPLES:
Some random keys and their respective inverse keys::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: key = S.random_key(); key # random 2 sage: S.inverse_key(key) # random 24 sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: key = S.random_key(); key # random 12 sage: S.inverse_key(key) # random 4 sage: S = ShiftCryptosystem(BinaryStrings()) sage: key = S.random_key(); key # random 1 sage: S.inverse_key(key) # random 1 sage: key = S.random_key(); key # random 0 sage: S.inverse_key(key) # random 0
Regardless of the value of a key, the addition of the key and its inverse must be equal to the alphabet size. This relationship holds exactly when the value of the key is non-zero::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: K = S.random_key() sage: while K == 0: ....: K = S.random_key() sage: invK = S.inverse_key(K) sage: K + invK == S.alphabet_size() True sage: invK + K == S.alphabet_size() True sage: K = S.random_key() sage: while K != 0: ....: K = S.random_key() sage: invK = S.inverse_key(K) sage: K + invK != S.alphabet_size() True sage: K; invK 0 0
TESTS:
The key ``K`` must satisfy the inequality `0 \leq K < n` with `n` being the size of the plaintext, ciphertext, and key spaces. For the shift cryptosystem, all these spaces are the same alphabet. This inequality must be satisfied for each of the supported alphabets. The capital letters of the English alphabet::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: S.inverse_key(S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=26) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S.inverse_key(-1) Traceback (most recent call last): ... ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The hexadecimal number system::
sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: S.inverse_key(S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=16) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S.inverse_key(-1) Traceback (most recent call last): ... ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem.
The binary number system::
sage: S = ShiftCryptosystem(BinaryStrings()) sage: S.inverse_key(S.alphabet_size()) Traceback (most recent call last): ... ValueError: K (=2) is outside the range of acceptable values for a key of this shift cryptosystem. sage: S.inverse_key(-1) Traceback (most recent call last): ... ValueError: K (=-1) is outside the range of acceptable values for a key of this shift cryptosystem. """ # Sanity check: the key K must satisfy the inequality # 0 <= K < n with n being the size of the plaintext, ciphertext, and # key spaces. For the shift cryptosystem, all these spaces are the # same alphabet. # Let A be the alphabet of this cryptosystem and let n be the # number of elements in A. If k is a key, then the corresponding # inverse key is -k mod n. else:
r""" Generate a random key within the key space of this shift cipher. The generated key is an integer `0 \leq k < n` with `n` being the size of the cipher domain. Thus there are `n` possible keys in the key space, which is the set `\ZZ / n\ZZ`. The key `k = 0` has no effect on either the plaintext or the ciphertext.
OUTPUT:
- A random key within the key space of this shift cryptosystem.
EXAMPLES::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: S.random_key() # random 18 sage: S = ShiftCryptosystem(BinaryStrings()) sage: S.random_key() # random 0 sage: S = ShiftCryptosystem(HexadecimalStrings()) sage: S.random_key() # random 5
Regardless of the value of a key, the addition of the key and its inverse must be equal to the alphabet size. This relationship holds exactly when the value of the key is non-zero::
sage: S = ShiftCryptosystem(AlphabeticStrings()) sage: K = S.random_key() sage: while K == 0: ....: K = S.random_key() sage: invK = S.inverse_key(K) sage: K + invK == S.alphabet_size() True sage: invK + K == S.alphabet_size() True sage: K = S.random_key() sage: while K != 0: ....: K = S.random_key() sage: invK = S.inverse_key(K) sage: K + invK != S.alphabet_size() True sage: K; invK 0 0 """ # Return a random element in ZZ/nZZ where n is the number of elements # in the plaintext/ciphertext alphabet and key space.
""" Create a substitution cryptosystem.
INPUT:
- ``S`` - a string monoid over some alphabet
OUTPUT:
- A substitution cryptosystem over the alphabet ``S``.
EXAMPLES::
sage: M = AlphabeticStrings() sage: E = SubstitutionCryptosystem(M) sage: E Substitution cryptosystem on Free alphabetic string monoid on A-Z sage: K = M([ 25-i for i in range(26) ]) sage: K ZYXWVUTSRQPONMLKJIHGFEDCBA sage: e = E(K) sage: m = M("THECATINTHEHAT") sage: e(m) GSVXZGRMGSVSZG
TESTS::
sage: M = AlphabeticStrings() sage: E = SubstitutionCryptosystem(M) sage: E == loads(dumps(E)) True """
""" See ``SubstitutionCryptosystem`` for full documentation.
EXAMPLES::
sage: M = AlphabeticStrings() sage: E = SubstitutionCryptosystem(M) sage: E Substitution cryptosystem on Free alphabetic string monoid on A-Z """ raise TypeError("S (= %s) must be a string monoid." % S)
""" Create a substitution cipher.
INPUT:
- ``K`` - a key which is a permutation of the cryptosystem alphabet
EXAMPLES::
sage: M = AlphabeticStrings() sage: E = SubstitutionCryptosystem(M) sage: E Substitution cryptosystem on Free alphabetic string monoid on A-Z sage: K = M([ 25-i for i in range(26) ]) sage: K ZYXWVUTSRQPONMLKJIHGFEDCBA sage: e = E(K) sage: m = M("THECATINTHEHAT") sage: e(m) GSVXZGRMGSVSZG """ raise TypeError("K (= %s) must be a string." % K) raise TypeError("K (= %s) must be a string in the key space." % K)
""" Return a string representation of self.
EXAMPLES::
sage: A = AlphabeticStrings() sage: S = SubstitutionCryptosystem(A) sage: S Substitution cryptosystem on Free alphabetic string monoid on A-Z sage: S._repr_() 'Substitution cryptosystem on Free alphabetic string monoid on A-Z' """
""" Generate a random key within the key space of this substitution cipher. The generated key is a permutation of the cryptosystem alphabet. Let `n` be the length of the alphabet. Then there are `n!` possible keys in the key space.
OUTPUT:
- A random key within the key space of this cryptosystem.
EXAMPLES::
sage: A = AlphabeticStrings() sage: S = SubstitutionCryptosystem(A) sage: K = S.random_key() sage: Ki = S.inverse_key(K) sage: M = "THECATINTHEHAT" sage: e = S(K) sage: d = S(Ki) sage: d(e(A(M))) == A(M) True """
""" The inverse key corresponding to the key ``K``. The specified key is a permutation of the cryptosystem alphabet.
INPUT:
- ``K`` - a key belonging to the key space of this cryptosystem
OUTPUT:
- The inverse key of ``K``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = SubstitutionCryptosystem(S) sage: K = E.random_key() sage: L = E.inverse_key(K) sage: M = S("THECATINTHEHAT") sage: e = E(K) sage: c = E(L) sage: c(e(M)) THECATINTHEHAT """
""" The encoding of the string ``M`` over the string monoid of this substitution cipher. For example, if the string monoid of this cryptosystem is :class:`AlphabeticStringMonoid`, then the encoding of ``M`` would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
- ``M`` - a string, possibly empty
OUTPUT:
- The encoding of ``M`` over the string monoid of this cryptosystem.
EXAMPLES::
sage: M = "Peter Pan(ning) for gold." sage: A = AlphabeticStrings() sage: S = SubstitutionCryptosystem(A) sage: S.encoding(M) == A.encoding(M) True """ try: return S.encoding(M) except Exception: raise TypeError("Argument M = %s does not encode in the cipher domain" % M)
""" Decrypt the ciphertext ``C`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this substitution cipher
- ``C`` - a string (possibly empty) over the string monoid of this cryptosystem.
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES::
sage: S = SubstitutionCryptosystem(AlphabeticStrings()) sage: K = S.random_key() sage: M = S.encoding("Don't substitute me!") sage: S.deciphering(K, S.enciphering(K, M)) == M True """
""" Encrypt the plaintext ``M`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this substitution cipher
- ``M`` - a string (possibly empty) over the string monoid of this cryptosystem.
OUTPUT:
- The ciphertext corresponding to the plaintext ``M``.
EXAMPLES::
sage: S = SubstitutionCryptosystem(AlphabeticStrings()) sage: K = S.random_key() sage: M = S.encoding("Don't substitute me.") sage: S.deciphering(K, S.enciphering(K, M)) == M True """
""" Create a transposition cryptosystem of block length ``n``.
INPUT:
- ``S`` - a string monoid over some alphabet
- ``n`` - integer `> 0`; a block length of a block permutation
OUTPUT:
- A transposition cryptosystem of block length ``n`` over the alphabet ``S``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = TranspositionCryptosystem(S,14) sage: E Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14 sage: K = [ 14-i for i in range(14) ] sage: K [14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1] sage: e = E(K) sage: e(S("THECATINTHEHAT")) TAHEHTNITACEHT
TESTS::
sage: S = AlphabeticStrings() sage: E = TranspositionCryptosystem(S,14) sage: E == loads(dumps(E)) True """
""" See ``TranspositionCryptosystem`` for full documentation.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = TranspositionCryptosystem(S,14) sage: E Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14 """ raise TypeError("S (= %s) must be a string monoid." % S)
""" Create a transposition cipher.
INPUT:
- ``K`` - a key which specifies a block permutation
EXAMPLES::
sage: M = AlphabeticStrings() sage: E = TranspositionCryptosystem(M,14) sage: E Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14 sage: K = [ 14-i for i in range(14) ] sage: K [14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1] sage: e = E(K) sage: m = M("THECATINTHEHAT") sage: e(m) TAHEHTNITACEHT """ except Exception: raise TypeError("K (= %s) must specify a permutation." % K) raise TypeError("K (= %s) must be a permutation or list specifying a permutation." % K)
""" Return a string representation of self.
EXAMPLES::
sage: A = AlphabeticStrings() sage: T = TranspositionCryptosystem(A, 14) sage: T Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14 sage: T._repr_() 'Transposition cryptosystem on Free alphabetic string monoid on A-Z of block length 14' """ self.cipher_domain(), self.block_length())
""" Generate a random key within the key space of this transposition cryptosystem. Let `n > 0` be the block length of this cryptosystem. Then there are `n!` possible keys.
OUTPUT:
- A random key within the key space of this cryptosystem.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = TranspositionCryptosystem(S, 14) sage: K = E.random_key() sage: Ki = E.inverse_key(K) sage: e = E(K) sage: d = E(Ki) sage: M = "THECATINTHEHAT" sage: C = e(S(M)) sage: d(S(C)) == S(M) True """
""" The inverse key corresponding to the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this transposition cipher
- ``check`` - bool (default: ``True``); check that ``K`` belongs to the key space of this cryptosystem.
OUTPUT:
- The inverse key corresponding to ``K``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = TranspositionCryptosystem(S, 14) sage: K = E.random_key() sage: Ki = E.inverse_key(K) sage: e = E(K) sage: d = E(Ki) sage: M = "THECATINTHEHAT" sage: C = e(S(M)) sage: d(S(C)) == S(M) True """ raise TypeError("Argument K (= %s) is not in the key space." % K)
""" The encoding of the string ``M`` over the string monoid of this transposition cipher. For example, if the string monoid of this cryptosystem is :class:`AlphabeticStringMonoid`, then the encoding of ``M`` would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
- ``M`` - a string, possibly empty
OUTPUT:
- The encoding of ``M`` over the string monoid of this cryptosystem.
EXAMPLES::
sage: M = "Transposition cipher is not about matrix transpose." sage: A = AlphabeticStrings() sage: T = TranspositionCryptosystem(A, 11) sage: T.encoding(M) == A.encoding(M) True """ try: return S.encoding(M) except Exception: raise TypeError("Argument M = %s does not encode in the cipher domain" % M)
""" Decrypt the ciphertext ``C`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this transposition cipher
- ``C`` - a string (possibly empty) over the string monoid of this cryptosystem.
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES::
sage: T = TranspositionCryptosystem(AlphabeticStrings(), 14) sage: K = T.random_key() sage: M = T.encoding("The cat in the hat.") sage: T.deciphering(K, T.enciphering(K, M)) == M True """
""" Encrypt the plaintext ``M`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this transposition cipher
- ``M`` - a string (possibly empty) over the string monoid of this cryptosystem
OUTPUT:
- The ciphertext corresponding to the plaintext ``M``.
EXAMPLES::
sage: T = TranspositionCryptosystem(AlphabeticStrings(), 14) sage: K = T.random_key() sage: M = T.encoding("The cat in the hat.") sage: T.deciphering(K, T.enciphering(K, M)) == M True """
""" Create a Vigenere cryptosystem of block length ``n``.
INPUT:
- ``S``-- a string monoid over some alphabet
- ``n`` - integer `> 0`; block length of an encryption/decryption key
OUTPUT:
- A Vigenere cryptosystem of block length ``n`` over the alphabet ``S``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = VigenereCryptosystem(S,14) sage: E Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14 sage: K = S('ABCDEFGHIJKLMN') sage: K ABCDEFGHIJKLMN sage: e = E(K) sage: e Cipher on Free alphabetic string monoid on A-Z sage: e(S("THECATINTHEHAT")) TIGFEYOUBQOSMG
TESTS::
sage: S = AlphabeticStrings() sage: E = VigenereCryptosystem(S,14) sage: E == loads(dumps(E)) True """
""" See ``VigenereCryptosystem`` for full documentation.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = VigenereCryptosystem(S,14) sage: E Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14 """ raise TypeError("S (= %s) must be a string monoid." % S)
""" Create a Vigenere cipher.
INPUT: A key which specifies a block permutation.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = VigenereCryptosystem(S,14) sage: E Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14 sage: K = S('ABCDEFGHIJKLMN') sage: K ABCDEFGHIJKLMN sage: e = E(K) sage: e Cipher on Free alphabetic string monoid on A-Z sage: e(S("THECATINTHEHAT")) TIGFEYOUBQOSMG """ try: K = S(K) except Exception: raise TypeError("K (= %s) must specify a string of length %s." % (K, m)) raise TypeError("K (= %s) must specify a string of length %s." % (K, m))
""" Return a string representation of self.
EXAMPLES::
sage: A = AlphabeticStrings() sage: V = VigenereCryptosystem(A, 14) sage: V Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14 sage: V._repr_() 'Vigenere cryptosystem on Free alphabetic string monoid on A-Z of period 14' """ self.cipher_domain(), self.period())
""" Generate a random key within the key space of this Vigenere cryptosystem. Let `n > 0` be the length of the cryptosystem alphabet and let `m > 0` be the block length of this cryptosystem. Then there are `n^m` possible keys.
OUTPUT:
- A random key within the key space of this cryptosystem.
EXAMPLES::
sage: A = AlphabeticStrings() sage: V = VigenereCryptosystem(A, 14) sage: M = "THECATINTHEHAT" sage: K = V.random_key() sage: Ki = V.inverse_key(K) sage: e = V(K) sage: d = V(Ki) sage: d(e(A(M))) == A(M) True """
""" The inverse key corresponding to the key ``K``.
INPUT:
- ``K`` - a key within the key space of this Vigenere cryptosystem
OUTPUT:
- The inverse key corresponding to ``K``.
EXAMPLES::
sage: S = AlphabeticStrings() sage: E = VigenereCryptosystem(S,14) sage: K = E.random_key() sage: L = E.inverse_key(K) sage: M = S("THECATINTHEHAT") sage: e = E(K) sage: c = E(L) sage: c(e(M)) THECATINTHEHAT """
""" The encoding of the string ``M`` over the string monoid of this Vigenere cipher. For example, if the string monoid of this cryptosystem is :class:`AlphabeticStringMonoid`, then the encoding of ``M`` would be its upper-case equivalent stripped of all non-alphabetic characters.
INPUT:
- ``M`` - a string, possibly empty
OUTPUT:
- The encoding of ``M`` over the string monoid of this cryptosystem.
EXAMPLES::
sage: A = AlphabeticStrings() sage: V = VigenereCryptosystem(A, 24) sage: M = "Jack and Jill went up the hill." sage: V.encoding(M) == A.encoding(M) True """ try: return S.encoding(M) except Exception: raise TypeError("Argument M = %s does not encode in the cipher domain" % M)
""" Decrypt the ciphertext ``C`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this Vigenere cipher
- ``C`` - a string (possibly empty) over the string monoid of this cryptosystem
OUTPUT:
- The plaintext corresponding to the ciphertext ``C``.
EXAMPLES::
sage: V = VigenereCryptosystem(AlphabeticStrings(), 24) sage: K = V.random_key() sage: M = V.encoding("Jack and Jill went up the hill.") sage: V.deciphering(K, V.enciphering(K, M)) == M True """
""" Encrypt the plaintext ``M`` using the key ``K``.
INPUT:
- ``K`` - a key belonging to the key space of this Vigenere cipher
- ``M`` - a string (possibly empty) over the string monoid of this cryptosystem
OUTPUT:
- The ciphertext corresponding to the plaintext ``M``.
EXAMPLES::
sage: V = VigenereCryptosystem(AlphabeticStrings(), 24) sage: K = V.random_key() sage: M = V.encoding("Jack and Jill went up the hill.") sage: V.deciphering(K, V.enciphering(K, M)) == M True """ |